LL-37 is a naturally occurring antimicrobial peptide that strengthens immune defenses and promotes tissue healing. It plays a role in fighting pathogens, reducing inflammation, and accelerating recovery from injuries or infections. LL-37 supplementation supports overall immunity, improves skin and wound healing, and enhances the body’s natural protective barriers.
Product Info
Molecular formula: C178H303N51O34
Molecular weight: 4493.0
Purity: 99%+
Sequence: [LL-37, 37 aa]



